Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG791600.3.p
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 841aa    MW: 92115.2 Da    PI: 6.2136
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG791600.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
             Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         k  ++t+eq+e+Le+l+  +++ps ++r++L +++    +++ +q+kvWFqNrR ++k+
                         5678****************************************************996 PP

                START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg..g 89 
                          +aee+ +e+++ka+ ++  Wv+++ +++g++++ +++ s++++g a+ra+g+v  +++++ e+l d++  W +++++ e+      g  g
                          789999****************************************************7777777777.***********999999999* PP

                START  90 alqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                          +++l +++++a+++lvp Rdf+++Ry+ + ++g+++++++S++     p+    +++vRae+lpSg+l++p+++g+s v++v+h dl++r
                          ********************************************99999999999*********************************** PP

                START 176 lphwllrslvksglaegaktwvatlqrqce 205
                          +++++lr+l++s+++ ++k+++ +l+++++
                          *********************999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.2892286IPR001356Homeobox domain
SMARTSM003895.3E-152490IPR001356Homeobox domain
CDDcd000861.26E-152787No hitNo description
PfamPF000466.2E-162885IPR001356Homeobox domain
CDDcd146863.77E-679118No hitNo description
PROSITE profilePS5084826.515155383IPR002913START domain
CDDcd088751.20E-73159375No hitNo description
SuperFamilySSF559612.47E-35164376No hitNo description
SMARTSM002347.6E-37164374IPR002913START domain
Gene3DG3DSA:3.30.530.201.1E-20164347IPR023393START-like domain
PfamPF018521.4E-46165373IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.76350.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2865260.0DQ286526.1 Zea mays rolled leaf 2 (rld2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468669.10.0hypothetical protein SORBIDRAFT_01g050000
SwissprotA2XBL90.0HOX10_ORYSI; Homeobox-leucine zipper protein HOX10
TrEMBLC5WMP70.0C5WMP7_SORBI; Putative uncharacterized protein Sb01g050000
STRINGSb01g050000.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.10.0HD-ZIP family protein